PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G12580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 437aa    MW: 47253.1 Da    PI: 4.4109
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G12580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.91.9e-3969167199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC++dC++apyfpa+q+++f n+h+lFG+sn+lk+l++l++e  +dam++l+y+Ae+ra+dPv G+++vi +l++qle   ael
  OPUNC08G12580.1  69 ACAACKYQRRKCNPDCPMAPYFPADQQRRFLNAHRLFGVSNILKTLRHLKPELCDDAMRTLIYQAEMRAHDPVGGCCRVIYDLERQLELDTAEL 162
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++ +
  OPUNC08G12580.1 163 NTVLH 167
                      98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.17868169IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3769165IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MTSTTTITTT TTNNHPVSTT TTASHQRQSL PIAARPPHSS GSGSGGSGSH RSTGGGGNGG  60
GGGGGTNQAC AACKYQRRKC NPDCPMAPYF PADQQRRFLN AHRLFGVSNI LKTLRHLKPE  120
LCDDAMRTLI YQAEMRAHDP VGGCCRVIYD LERQLELDTA ELNTVLHHLA MCRQAAATGA  180
SGSVAAAALP AGVLDDACAD LDVTSSNQPL LLSAEQEVVD ALYANQEADA AILQADGHHN  240
QDENQREQHH GQPQQLYDYF YYDSTAGDDV SSKPNLDINV DGMQHFDFDT NYDAEHKVEL  300
TSDHQMPVGV DEQHQIDDKE FEIKSAPSLV DVFDMRQEQV QTVDVNTDIE VKEMVDMNAD  360
IDVKTMVDEN GNIDVIKTMV DVNADIVDVV KTVVDVNGDI GVKEELPELE NGKIIAGDAT  420
QMAESSHCRL GLGVSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0053880.0AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649280.10.0PREDICTED: uncharacterized protein LOC9266602
TrEMBLA0A0E0LUQ20.0A0A0E0LUQ2_ORYPU; Uncharacterized protein
STRINGORGLA08G0122300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-37LOB domain-containing protein 22